PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003283m
Common NameCARUB_v10003283mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 314aa    MW: 36004.5 Da    PI: 5.1262
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003283mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding476e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed+ l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Carubv10003283m 16 RGPWSPQEDLTLITFIQKHGHLNWRSLPKLAGLMRCGKSCRLRWINYL 63
                     89********************************************97 PP

2Myb_DNA-binding50.35.5e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  Carubv10003283m  69 RGNFSKEEEDTIIHYHQTLGNK-WSKIASFLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.7281163IPR017930Myb domain
SuperFamilySSF466895.14E-2914110IPR009057Homeodomain-like
SMARTSM007171.2E-111565IPR001005SANT/Myb domain
PfamPF002493.6E-141663IPR001005SANT/Myb domain
CDDcd001673.49E-91863No hitNo description
PROSITE profilePS5129423.80664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2667118IPR009057Homeodomain-like
SMARTSM007173.0E-1468116IPR001005SANT/Myb domain
PfamPF002495.1E-1569114IPR001005SANT/Myb domain
CDDcd001671.28E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009866Biological Processinduced systemic resistance, ethylene mediated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0071732Biological Processcellular response to nitric oxide
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRGRAPCCD KNKVKRGPWS PQEDLTLITF IQKHGHLNWR SLPKLAGLMR CGKSCRLRWI  60
NYLRPDVKRG NFSKEEEDTI IHYHQTLGNK WSKIASFLPG RTDNEIKNVW NTHLKKRLST  120
RSSSFSSSSS SSSISSTHDQ STEEDHDKKC EGAHEEEEKS ELNDSQDSAS HSQDKCIHTK  180
PELHEVNNEL NEIQFLLDHD DFDDTTSEFL QNNDMLFPLD SLLHDHQTHI STTGGVTQEV  240
TKSQSFDHPQ VLDNISCGFH EDTNIGESDL WRQLLVESTL PTSSPNNEYD EWFNFIDNQT  300
YFDDFNFVGE VCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26161207110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289717.10.0hypothetical protein CARUB_v10003283mg
TrEMBLR0HC590.0R0HC59_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__4638__AT1G56160.11e-161(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56160.11e-158myb domain protein 72